Custom Peptide Synthesis

Customization of High Purity vosoritide

Bulk quotation · · Price on Request

Procurement answer: Customization of High Purity vosoritide is a peptide-related raw material inquiry option. This item appears in the supplied third-party catalog reference; availability for Hytanbio projects must be confirmed by quotation. Request a current specification, batch COA, MOQ, lead time and destination review before committing to an order. Public parameters below are source-listed references, not guarantees for a current batch.

Customization of High Purity vosoritide specifications and available formats

The first step is to match identity and form to the intended laboratory or industrial process. A quoted batch may differ from a public catalog reference, especially in salt form, purity target, residual solvents, packaging and storage. The table collects only fields that were present and plausible in the supplied material. Missing values are deliberately left for technical confirmation rather than filled with estimates. For lyophilized projects, the strength list reflects supplied commercial variants; final label wording and fill tolerance belong in the signed specification.

CAS number 14474-71-6
Molecular formula C176H290N56O51S3
Molecular weight 4102.77
Sequence PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39)
Source-listed purity (HPLC): ≥98.0%

Batch quality and documentation

Ask for the current batch COA and agree on the analytical method before procurement. HPLC purity, identity testing, water content, residual solvent limits and microbiological or endotoxin testing are project-specific; none can be presumed from a product name alone. The team can review the requested tests, batch traceability and export documents against the planned destination. Certificate images and packaging mockups on this site do not substitute for the actual certificate number, issuing body, covered legal entity or batch record.

MOQ, packaging and quotation

Send the target quantity, strength or bulk scale, expected annual demand, destination country, required documents and private-label artwork status. We review technical feasibility and current inventory before confirming MOQ, lead time and quote. The packaging image is a design reference rather than a photograph of the offered batch. Products listed for research or industrial sourcing are not presented as medicines or consumer products; buyers are responsible for their end-use and local import assessment.

Request Customization of High Purity vosoritide quote